PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g053220.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 226aa    MW: 26362.2 Da    PI: 4.7246
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g053220.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.94.7e-202373656
                        S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +f++eq+++Le++F+++ ++  +++ eLA+ lgL+ rqV +WFqNrRa++k
  Sopim06g053220.0.1 23 RFSDEQVKVLESMFNQKTKLEPSKKLELARDLGLQPRQVAIWFQNRRARWK 73
                        69************************************************9 PP

2HD-ZIP_I/II1216e-3922111493
         HD-ZIP_I/II   4 rrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                         +r+s+eqvk+LE++F++++kLep++K elar+Lglqprqva+WFqnrRAR+ktkqlE++y++Lk+++d+l+ + e+L+ke+e+L ++l+e
  Sopim06g053220.0.1  22 KRFSDEQVKVLESMFNQKTKLEPSKKLELARDLGLQPRQVAIWFQNRRARWKTKQLEHEYRRLKDEFDNLAMKFESLKKEKESLLKQLQE 111
                         8**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.89E-191377IPR009057Homeodomain-like
PROSITE profilePS5007117.1671575IPR001356Homeobox domain
SMARTSM003899.3E-181779IPR001356Homeobox domain
PfamPF000461.8E-172373IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-212382IPR009057Homeodomain-like
CDDcd000866.36E-162376No hitNo description
PRINTSPR000313.7E-64655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000313.7E-65571IPR000047Helix-turn-helix motif
PfamPF021832.5E-1375116IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEVAEDSSPV ECSKKKSHED GKRFSDEQVK VLESMFNQKT KLEPSKKLEL ARDLGLQPRQ  60
VAIWFQNRRA RWKTKQLEHE YRRLKDEFDN LAMKFESLKK EKESLLKQLQ ELSDQMENNH  120
AGCSRSQDSI DSEIYTSSEN IEAEVDVKNN IPVCINTSLD HNRIKGTDSD REGTLFEHLR  180
WKEEEEFWNM EELGDSSLGS PEHWYAVGPG DSFDLSCENS KWWEL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11317KKKSH
26775RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240976.11e-166PREDICTED: homeobox-leucine zipper protein ATHB-12-like
RefseqXP_010322235.11e-166PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLK4C6091e-166K4C609_SOLLC; Uncharacterized protein
STRINGSolyc06g053220.2.11e-165(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-31homeobox 7